SCOPe 2.08: Domain d2pg3a1: 2pg3 A:1-230

Lineage for d2pg3a1 (2pg3 A:1-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Queuosine biosynthesis protein QueC [159496] (1 species)

7. Species Erwinia carotovora [TaxId:554] [159497] (1 PDB entry)
   Uniprot Q6D820 1-230

8. Domain d2pg3a1: 2pg3 A:1-230 [149454]
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d2pg3a1

PDB Entry: 2pg3, 2.4 Å

PDB Description: crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution

PDB Compounds: (A:) Queuosine biosynthesis protein queC

SCOPe Domain Sequences for d2pg3a1:

Sequence, based on SEQRES records:

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}
mkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahkv
ldvgllnelatssltrdsipvpdydanaqgipntfvpgrnilfltlasiyayqvgaeavi
tgvcetdfsgypdcrdefvkalnqaivlgiardirfetplmwlnkaetwaladyyqqldt
vryhtltcyngikgdgcgqcaachlranglaqyqkdaatvmaslkqkvgl

Sequence, based on observed residues (ATOM records):

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}
mkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahkv
ldvgllnelatssltrdsipvpdntfvpgrnilfltlasiyayqvgaeavitgvcetdfs
gypdcrdefvkalnqaivlgiardirfetplmwlnkaetwaladyyqqldtvryhtltcy
ngikgdgcgqcaachlranglaqyqkdaatvmaslkqkvgl

Timeline for d2pg3a1:

• d2pg3a1 first appeared in SCOP 1.75
  
• d2pg3a1 appears in SCOPe 2.07