SCOPe 2.02: Domain d2peqa1: 2peq A:2-109

Lineage for d2peqa1 (2peq A:2-109)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (3 species)

7. Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
   Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111

8. Domain d2peqa1: 2peq A:2-109 [149443]
   automatically matched to 2PEM A:2-111

Details for d2peqa1

PDB Entry: 2peq, 1.9 Å

PDB Description: Crystal structure of RbcX, crystal form II

PDB Compounds: (A:) orf134

SCOPe Domain Sequences for d2peqa1:

Sequence; same for both SEQRES and ATOM records:

>d2peqa1 a.280.1.1 (A:2-109) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

Timeline for d2peqa1:

• d2peqa1 first appeared in SCOP 1.75
  
• d2peqa1 appears in SCOPe 2.01
  
• d2peqa1 is called d2peqa_ in SCOPe 2.03
  
• d2peqa1 appears in the current release, SCOPe 2.08, called d2peqa_