SCOPe 2.08: Domain d2peqa_: 2peq A:

Lineage for d2peqa_ (2peq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries)
   Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111

8. Domain d2peqa_: 2peq A: [149443]
   automated match to d2pema1

Details for d2peqa_

PDB Entry: 2peq, 1.9 Å

PDB Description: Crystal structure of RbcX, crystal form II

PDB Compounds: (A:) orf134

SCOPe Domain Sequences for d2peqa_:

Sequence; same for both SEQRES and ATOM records:

>d2peqa_ a.280.1.1 (A:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

Timeline for d2peqa_:

• d2peqa_ first appeared in SCOP 1.75, called d2peqa1
  
• d2peqa_ appears in SCOPe 2.07