Lineage for d2peob1 (2peo B:1-114)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 929036Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 929037Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 929038Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 929039Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 929040Species Anabaena sp. [TaxId:1167] [158619] (1 PDB entry)
    Uniprot Q44212 1-115
  8. 929042Domain d2peob1: 2peo B:1-114 [149442]
    automatically matched to 2PEO A:1-115

Details for d2peob1

PDB Entry: 2peo (more details), 2.5 Å

PDB Description: crystal structure of rbcx from anabaena ca
PDB Compounds: (B:) RbcX protein

SCOPe Domain Sequences for d2peob1:

Sequence, based on SEQRES records: (download)

>d2peob1 a.280.1.1 (B:1-114) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls

Sequence, based on observed residues (ATOM records): (download)

>d2peob1 a.280.1.1 (B:1-114) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls

SCOPe Domain Coordinates for d2peob1:

Click to download the PDB-style file with coordinates for d2peob1.
(The format of our PDB-style files is described here.)

Timeline for d2peob1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2peoa1