Class a: All alpha proteins [46456] (284 folds) |
Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) |
Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
Protein RuBisCo chaperone RbcX [158617] (3 species) |
Species Anabaena sp. [TaxId:1167] [158619] (1 PDB entry) Uniprot Q44212 1-115 |
Domain d2peob1: 2peo B:1-114 [149442] automatically matched to 2PEO A:1-115 |
PDB Entry: 2peo (more details), 2.5 Å
SCOPe Domain Sequences for d2peob1:
Sequence, based on SEQRES records: (download)
>d2peob1 a.280.1.1 (B:1-114) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]} mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls
>d2peob1 a.280.1.1 (B:1-114) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]} mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls
Timeline for d2peob1: