SCOPe 2.01: Domain d2peoa1: 2peo A:1-115

Lineage for d2peoa1 (2peo A:1-115)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (3 species)

7. Species Anabaena sp. [TaxId:1167] [158619] (1 PDB entry)
   Uniprot Q44212 1-115

8. Domain d2peoa1: 2peo A:1-115 [149441]

Details for d2peoa1

PDB Entry: 2peo, 2.5 Å

PDB Description: crystal structure of rbcx from anabaena ca

PDB Compounds: (A:) RbcX protein

SCOPe Domain Sequences for d2peoa1:

Sequence, based on SEQRES records:

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

Sequence, based on observed residues (ATOM records):

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

Timeline for d2peoa1:

• d2peoa1 first appeared in SCOP 1.75
  
• d2peoa1 appears in SCOPe 2.02
  
• d2peoa1 appears in the current release, SCOPe 2.08