SCOPe 2.03: Domain d2penf_: 2pen F:

Lineage for d2penf_ (2pen F:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (3 species)

7. Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
   Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111

8. Domain d2penf_: 2pen F: [149440]
   automated match to d2pema1

Details for d2penf_

PDB Entry: 2pen, 2.8 Å

PDB Description: crystal structure of rbcx, crystal form i

PDB Compounds: (F:) orf134

SCOPe Domain Sequences for d2penf_:

Sequence; same for both SEQRES and ATOM records:

>d2penf_ a.280.1.1 (F:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvds

Timeline for d2penf_:

• d2penf_ first appeared in SCOP 1.75, called d2penf1
  
• d2penf_ was called d2penf1 in SCOPe 2.02
  
• d2penf_ appears in SCOPe 2.04
  
• d2penf_ appears in the current release, SCOPe 2.08