SCOPe 2.06: Domain d2pend_: 2pen D:

Lineage for d2pend_ (2pen D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries)
   Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111

8. Domain d2pend_: 2pen D: [149438]
   automated match to d2pema1

Details for d2pend_

PDB Entry: 2pen, 2.8 Å

PDB Description: crystal structure of rbcx, crystal form i

PDB Compounds: (D:) orf134

SCOPe Domain Sequences for d2pend_:

Sequence; same for both SEQRES and ATOM records:

>d2pend_ a.280.1.1 (D:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

Timeline for d2pend_:

• d2pend_ first appeared in SCOP 1.75, called d2pend1
  
• d2pend_ appears in SCOPe 2.05
  
• d2pend_ appears in SCOPe 2.07
  
• d2pend_ appears in the current release, SCOPe 2.08