Lineage for d2pend1 (2pen D:3-109)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781293Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 781294Superfamily a.280.1: RbcX-like [158615] (1 family) (S)
  5. 781295Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 781296Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 781300Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 781321Domain d2pend1: 2pen D:3-109 [149438]
    automatically matched to 2PEM A:2-111

Details for d2pend1

PDB Entry: 2pen (more details), 2.8 Å

PDB Description: crystal structure of rbcx, crystal form i
PDB Compounds: (D:) orf134

SCOP Domain Sequences for d2pend1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pend1 a.280.1.1 (D:3-109) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

SCOP Domain Coordinates for d2pend1:

Click to download the PDB-style file with coordinates for d2pend1.
(The format of our PDB-style files is described here.)

Timeline for d2pend1: