Lineage for d2pena_ (2pen A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351974Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2351975Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2351976Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2351977Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2351983Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 2352005Domain d2pena_: 2pen A: [149435]
    automated match to d2pema1

Details for d2pena_

PDB Entry: 2pen (more details), 2.8 Å

PDB Description: crystal structure of rbcx, crystal form i
PDB Compounds: (A:) orf134

SCOPe Domain Sequences for d2pena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pena_ a.280.1.1 (A:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

SCOPe Domain Coordinates for d2pena_:

Click to download the PDB-style file with coordinates for d2pena_.
(The format of our PDB-style files is described here.)

Timeline for d2pena_: