Lineage for d2pena1 (2pen A:2-111)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102998Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 1102999Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 1103000Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 1103001Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 1103005Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 1103023Domain d2pena1: 2pen A:2-111 [149435]
    automatically matched to 2PEM A:2-111

Details for d2pena1

PDB Entry: 2pen (more details), 2.8 Å

PDB Description: crystal structure of rbcx, crystal form i
PDB Compounds: (A:) orf134

SCOPe Domain Sequences for d2pena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pena1 a.280.1.1 (A:2-111) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

SCOPe Domain Coordinates for d2pena1:

Click to download the PDB-style file with coordinates for d2pena1.
(The format of our PDB-style files is described here.)

Timeline for d2pena1: