Lineage for d2pekf1 (2pek F:3-111)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781293Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 781294Superfamily a.280.1: RbcX-like [158615] (1 family) (S)
  5. 781295Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 781296Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 781300Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 781335Domain d2pekf1: 2pek F:3-111 [149428]
    automatically matched to 2PEK A:2-111
    mutant

Details for d2pekf1

PDB Entry: 2pek (more details), 3.1 Å

PDB Description: Crystal structure of RbcX point mutant Q29A
PDB Compounds: (F:) orf134

SCOP Domain Sequences for d2pekf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pekf1 a.280.1.1 (F:3-111) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

SCOP Domain Coordinates for d2pekf1:

Click to download the PDB-style file with coordinates for d2pekf1.
(The format of our PDB-style files is described here.)

Timeline for d2pekf1: