Lineage for d2peke_ (2pek E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020902Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2020903Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2020904Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2020905Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2020945Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries)
  8. 2020958Domain d2peke_: 2pek E: [149427]
    automated match to d2peoa1
    mutant

Details for d2peke_

PDB Entry: 2pek (more details), 3.1 Å

PDB Description: Crystal structure of RbcX point mutant Q29A
PDB Compounds: (E:) orf134

SCOPe Domain Sequences for d2peke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peke_ a.280.1.1 (E:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv

SCOPe Domain Coordinates for d2peke_:

Click to download the PDB-style file with coordinates for d2peke_.
(The format of our PDB-style files is described here.)

Timeline for d2peke_: