| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
| Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
| Protein RuBisCo chaperone RbcX [158617] (5 species) |
| Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries) |
| Domain d2pekb_: 2pek B: [149424] automated match to d2peoa1 mutant |
PDB Entry: 2pek (more details), 3.1 Å
SCOPe Domain Sequences for d2pekb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pekb_ a.280.1.1 (B:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
Timeline for d2pekb_: