![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
![]() | Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
![]() | Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
![]() | Protein RuBisCo chaperone RbcX [158617] (5 species) |
![]() | Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries) Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111 |
![]() | Domain d2peka1: 2pek A:2-111 [149423] mutant |
PDB Entry: 2pek (more details), 3.1 Å
SCOPe Domain Sequences for d2peka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2peka1 a.280.1.1 (A:2-111) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]} efkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamm lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
Timeline for d2peka1: