Lineage for d2pejf1 (2pej F:4-111)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781293Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 781294Superfamily a.280.1: RbcX-like [158615] (1 family) (S)
  5. 781295Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 781296Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 781300Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 781347Domain d2pejf1: 2pej F:4-111 [149422]
    automatically matched to 2PEJ A:3-111
    mutant

Details for d2pejf1

PDB Entry: 2pej (more details), 3.4 Å

PDB Description: crystal structure of rbcx point mutant y17a/y20l
PDB Compounds: (F:) orf134

SCOP Domain Sequences for d2pejf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pejf1 a.280.1.1 (F:4-111) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
kkvaketaitlqsaltlqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleammle
nkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

SCOP Domain Coordinates for d2pejf1:

Click to download the PDB-style file with coordinates for d2pejf1.
(The format of our PDB-style files is described here.)

Timeline for d2pejf1: