Lineage for d2peil1 (2pei L:3-109)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 929036Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 929037Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 929038Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 929039Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 929043Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (9 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 929060Domain d2peil1: 2pei L:3-109 [149416]
    automatically matched to 2PEI A:3-109

Details for d2peil1

PDB Entry: 2pei (more details), 2.7 Å

PDB Description: Crystal structure of selenomethionine-labeled RbcX
PDB Compounds: (L:) orf134

SCOPe Domain Sequences for d2peil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peil1 a.280.1.1 (L:3-109) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

SCOPe Domain Coordinates for d2peil1:

Click to download the PDB-style file with coordinates for d2peil1.
(The format of our PDB-style files is described here.)

Timeline for d2peil1: