| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
| Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
| Protein RuBisCo chaperone RbcX [158617] (5 species) |
| Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries) Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111 |
| Domain d2peil_: 2pei L: [149416] automated match to d2peia1 |
PDB Entry: 2pei (more details), 2.7 Å
SCOPe Domain Sequences for d2peil_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2peil_ a.280.1.1 (L:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
Timeline for d2peil_: