Lineage for d2peig_ (2pei G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351974Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2351975Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2351976Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2351977Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2351983Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 2351992Domain d2peig_: 2pei G: [149411]
    automated match to d2peia1

Details for d2peig_

PDB Entry: 2pei (more details), 2.7 Å

PDB Description: Crystal structure of selenomethionine-labeled RbcX
PDB Compounds: (G:) orf134

SCOPe Domain Sequences for d2peig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peig_ a.280.1.1 (G:) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl

SCOPe Domain Coordinates for d2peig_:

Click to download the PDB-style file with coordinates for d2peig_.
(The format of our PDB-style files is described here.)

Timeline for d2peig_: