SCOP 1.75: Domain d2pegb1: 2peg B:1-146

Lineage for d2pegb1 (2peg B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (7 PDB entries)

8. Domain d2pegb1: 2peg B:1-146 [149404]
   Other proteins in same PDB: d2pega1
   automatically matched to d1hbhb_
   complexed with ace, hem

Details for d2pegb1

PDB Entry: 2peg, 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state

PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2pegb1:

Sequence, based on SEQRES records:

>d2pegb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Sequence, based on observed residues (ATOM records):

>d2pegb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgnaeaiignanvaahgi
kvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftae
tqgafqkflavvvsalgkqyh

Timeline for d2pegb1:

• d2pegb1 is new in SCOP 1.75
  
• d2pegb1 is called d2pegb_ in SCOPe 2.01
  
• d2pegb1 appears in the current release, SCOPe 2.08, called d2pegb_