Lineage for d2pegb1 (2peg B:1-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759065Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (7 PDB entries)
  8. 759068Domain d2pegb1: 2peg B:1-146 [149404]
    Other proteins in same PDB: d2pega1
    automatically matched to d1hbhb_
    complexed with ace, hem

Details for d2pegb1

PDB Entry: 2peg (more details), 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state
PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2pegb1:

Sequence, based on SEQRES records: (download)

>d2pegb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Sequence, based on observed residues (ATOM records): (download)

>d2pegb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgnaeaiignanvaahgi
kvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftae
tqgafqkflavvvsalgkqyh

SCOP Domain Coordinates for d2pegb1:

Click to download the PDB-style file with coordinates for d2pegb1.
(The format of our PDB-style files is described here.)

Timeline for d2pegb1: