SCOPe 2.08: Domain d2pegb_: 2peg B:

Lineage for d2pegb_ (2peg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)

8. Domain d2pegb_: 2peg B: [149404]
   Other proteins in same PDB: d2pega_
   automated match to d1hbhb_
   complexed with hem

Details for d2pegb_

PDB Entry: 2peg, 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2pegb_:

Sequence, based on SEQRES records:

>d2pegb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Sequence, based on observed residues (ATOM records):

>d2pegb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgnaeaiignanvaahgi
kvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftae
tqgafqkflavvvsalgkqyh

Timeline for d2pegb_:

• d2pegb_ first appeared in SCOP 1.75, called d2pegb1
  
• d2pegb_ appears in SCOPe 2.07