Lineage for d2pega1 (2peg A:1-142)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758592Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (7 PDB entries)
  8. 758595Domain d2pega1: 2peg A:1-142 [149403]
    Other proteins in same PDB: d2pegb1
    automatically matched to d1hbha_
    complexed with ace, hem

Details for d2pega1

PDB Entry: 2peg (more details), 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOP Domain Sequences for d2pega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pega1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d2pega1:

Click to download the PDB-style file with coordinates for d2pega1.
(The format of our PDB-style files is described here.)

Timeline for d2pega1: