SCOPe 2.07: Domain d2pe7a_: 2pe7 A:

Lineage for d2pe7a_ (2pe7 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein automated matches [190195] (6 species)
   not a true protein

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)

8. Domain d2pe7a_: 2pe7 A: [149398]
   automated match to d1thva_
   complexed with eu, pdc, tla

Details for d2pe7a_

PDB Entry: 2pe7, 1.46 Å

PDB Description: Thaumatin from Thaumatococcus Danielli in complex with tris-dipicolinate Europium

PDB Compounds: (A:) Preprothaumatin I

SCOPe Domain Sequences for d2pe7a_:

Sequence; same for both SEQRES and ATOM records:

>d2pe7a_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d2pe7a_:

• d2pe7a_ first appeared in SCOP 1.75, called d2pe7a1
  
• d2pe7a_ appears in SCOPe 2.06
  
• d2pe7a_ appears in the current release, SCOPe 2.08