Lineage for d2pe7a_ (2pe7 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943539Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 943540Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 943541Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
  6. 943567Protein automated matches [190195] (3 species)
    not a true protein
  7. 943568Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (24 PDB entries)
  8. 943580Domain d2pe7a_: 2pe7 A: [149398]
    automated match to d1thva_
    complexed with eu, pdc, tla

Details for d2pe7a_

PDB Entry: 2pe7 (more details), 1.46 Å

PDB Description: Thaumatin from Thaumatococcus Danielli in complex with tris-dipicolinate Europium
PDB Compounds: (A:) Preprothaumatin I

SCOPe Domain Sequences for d2pe7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pe7a_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d2pe7a_:

Click to download the PDB-style file with coordinates for d2pe7a_.
(The format of our PDB-style files is described here.)

Timeline for d2pe7a_: