SCOP 1.75: Domain d2pe7a1: 2pe7 A:1-207

Lineage for d2pe7a1 (2pe7 A:1-207)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (19 PDB entries)
   Uniprot P02883

8. Domain d2pe7a1: 2pe7 A:1-207 [149398]
   automatically matched to d1thva_
   complexed with eu, pdc, tla

Details for d2pe7a1

PDB Entry: 2pe7, 1.46 Å

PDB Description: Thaumatin from Thaumatococcus Danielli in complex with tris-dipicolinate Europium

PDB Compounds: (A:) Preprothaumatin I

SCOP Domain Sequences for d2pe7a1:

Sequence; same for both SEQRES and ATOM records:

>d2pe7a1 b.25.1.1 (A:1-207) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d2pe7a1:

• d2pe7a1 is new in SCOP 1.75
  
• d2pe7a1 is called d2pe7a_ in SCOPe 2.01
  
• d2pe7a1 appears in the current release, SCOPe 2.08, called d2pe7a_