![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
![]() | Domain d2pe5c2: 2pe5 C:62-329 [149397] Other proteins in same PDB: d2pe5a1, d2pe5b1, d2pe5c1 automatically matched to d1jyea_ protein/DNA complex; complexed with 145 |
PDB Entry: 2pe5 (more details), 3.5 Å
SCOPe Domain Sequences for d2pe5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pe5c2 c.93.1.1 (C:62-329) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv drllqlsqgqavkgnqllpvslvkrktt
Timeline for d2pe5c2:
![]() Domains from other chains: (mouse over for more information) d2pe5a1, d2pe5a2, d2pe5b1, d2pe5b2 |