Lineage for d2pe5a2 (2pe5 A:62-329)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390243Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1390244Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1390245Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1390348Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 1390349Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 1390369Domain d2pe5a2: 2pe5 A:62-329 [149393]
    Other proteins in same PDB: d2pe5a1, d2pe5b1, d2pe5c1
    automatically matched to d1jyea_
    protein/DNA complex; complexed with 145

Details for d2pe5a2

PDB Entry: 2pe5 (more details), 3.5 Å

PDB Description: crystal structure of the lac repressor bound to onpg in repressed state
PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2pe5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pe5a2 c.93.1.1 (A:62-329) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrktt

SCOPe Domain Coordinates for d2pe5a2:

Click to download the PDB-style file with coordinates for d2pe5a2.
(The format of our PDB-style files is described here.)

Timeline for d2pe5a2: