SCOPe 2.06: Domain d2pd1d2: 2pd1 D:1-100

Lineage for d2pd1d2 (2pd1 D:1-100)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.11: PA3566-like [110970] (5 proteins)
subfamily of Pfam PF03992
Protein Hypothetical protein NE2512 [160285] (1 species)
Species Nitrosomonas europaea [TaxId:915] [160286] (1 PDB entry)
Uniprot Q82S47 1-100
Domain d2pd1d2: 2pd1 D:1-100 [149390]
Other proteins in same PDB: d2pd1a2, d2pd1a3, d2pd1c3, d2pd1d3
automated match to d2pd1a1
complexed with act

Details for d2pd1d2

PDB Entry: 2pd1 (more details), 1.86 Å

PDB Description: Crystal structure of NE2512 protein of unknown function from Nitrosomonas europaea

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2pd1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pd1d2 d.58.4.11 (D:1-100) Hypothetical protein NE2512 {Nitrosomonas europaea [TaxId: 915]}
mtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafadea
grqahlngqiaaalmanaatllssppniekvellaaklpa

SCOPe Domain Coordinates for d2pd1d2:

Click to download the PDB-style file with coordinates for d2pd1d2.
(The format of our PDB-style files is described here.)

Timeline for d2pd1d2: