Lineage for d2pd1d2 (2pd1 D:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949910Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 2949921Protein Hypothetical protein NE2512 [160285] (1 species)
  7. 2949922Species Nitrosomonas europaea [TaxId:915] [160286] (1 PDB entry)
    Uniprot Q82S47 1-100
  8. 2949926Domain d2pd1d2: 2pd1 D:1-100 [149390]
    Other proteins in same PDB: d2pd1a2, d2pd1a3, d2pd1c3, d2pd1d3
    automated match to d2pd1a1
    complexed with act

Details for d2pd1d2

PDB Entry: 2pd1 (more details), 1.86 Å

PDB Description: Crystal structure of NE2512 protein of unknown function from Nitrosomonas europaea
PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2pd1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pd1d2 d.58.4.11 (D:1-100) Hypothetical protein NE2512 {Nitrosomonas europaea [TaxId: 915]}
mtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafadea
grqahlngqiaaalmanaatllssppniekvellaaklpa

SCOPe Domain Coordinates for d2pd1d2:

Click to download the PDB-style file with coordinates for d2pd1d2.
(The format of our PDB-style files is described here.)

Timeline for d2pd1d2: