| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
| Protein Hypothetical protein NE2512 [160285] (1 species) |
| Species Nitrosomonas europaea [TaxId:915] [160286] (1 PDB entry) Uniprot Q82S47 1-100 |
| Domain d2pd1c2: 2pd1 C:1-100 [149389] Other proteins in same PDB: d2pd1a2, d2pd1a3, d2pd1c3, d2pd1d3 automated match to d2pd1a1 complexed with act |
PDB Entry: 2pd1 (more details), 1.86 Å
SCOPe Domain Sequences for d2pd1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pd1c2 d.58.4.11 (C:1-100) Hypothetical protein NE2512 {Nitrosomonas europaea [TaxId: 915]}
mtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafadea
grqahlngqiaaalmanaatllssppniekvellaaklpa
Timeline for d2pd1c2: