SCOPe 2.05: Domain d2pd1b_: 2pd1 B:

Lineage for d2pd1b_ (2pd1 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (5 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein NE2512 [160285] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [160286] (1 PDB entry)
   Uniprot Q82S47 1-100

8. Domain d2pd1b_: 2pd1 B: [149388]
   automated match to d2pd1a1
   complexed with act

Details for d2pd1b_

PDB Entry: 2pd1, 1.86 Å

PDB Description: Crystal structure of NE2512 protein of unknown function from Nitrosomonas europaea

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2pd1b_:

Sequence; same for both SEQRES and ATOM records:

>d2pd1b_ d.58.4.11 (B:) Hypothetical protein NE2512 {Nitrosomonas europaea [TaxId: 915]}
mtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafadea
grqahlngqiaaalmanaatllssppniekvellaaklpa

Timeline for d2pd1b_:

• d2pd1b_ first appeared in SCOP 1.75, called d2pd1b1
  
• d2pd1b_ appears in SCOPe 2.04
  
• d2pd1b_ appears in SCOPe 2.06
  
• d2pd1b_ appears in the current release, SCOPe 2.08