Lineage for d2pc9c1 (2pc9 C:212-527)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845757Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 845758Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 845759Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)
  6. 845770Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (3 species)
  7. 845782Species Thermus thermophilus [TaxId:274] [82553] (3 PDB entries)
    Uniprot Q7SIC6
  8. 845789Domain d2pc9c1: 2pc9 C:212-527 [149382]
    Other proteins in same PDB: d2pc9a2, d2pc9b2, d2pc9c2, d2pc9d2
    automatically matched to d1j3ba1
    complexed with atp, ca, po4

Details for d2pc9c1

PDB Entry: 2pc9 (more details), 2.4 Å

PDB Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
PDB Compounds: (C:) Phosphoenolpyruvate carboxykinase [ATP]

SCOP Domain Sequences for d2pc9c1:

Sequence, based on SEQRES records: (download)

>d2pc9c1 c.91.1.1 (C:212-527) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvagtergvtepratfs
acfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaa
lsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfq
kyasgvakevaeagpr

Sequence, based on observed residues (ATOM records): (download)

>d2pc9c1 c.91.1.1 (C:212-527) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvtepratfsacfgapf
lpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalen
vpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfqkyasgva
kevaeagpr

SCOP Domain Coordinates for d2pc9c1:

Click to download the PDB-style file with coordinates for d2pc9c1.
(The format of our PDB-style files is described here.)

Timeline for d2pc9c1: