Lineage for d2pc9b2 (2pc9 B:2-211)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149704Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2149755Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2149770Species Thermus thermophilus [TaxId:274] [82555] (4 PDB entries)
    Uniprot Q7SIC6
  8. 2149777Domain d2pc9b2: 2pc9 B:2-211 [149381]
    Other proteins in same PDB: d2pc9a1, d2pc9b1, d2pc9c1, d2pc9d1
    automated match to d1j3ba2
    complexed with atp, ca, po4

Details for d2pc9b2

PDB Entry: 2pc9 (more details), 2.4 Å

PDB Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d2pc9b2:

Sequence, based on SEQRES records: (download)

>d2pc9b2 c.109.1.1 (B:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
rlvlivgtkyageikksiftvmnylmpkrg

Sequence, based on observed residues (ATOM records): (download)

>d2pc9b2 c.109.1.1 (B:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrffvpgftvvhapyfqavperdgtrsevfvgisfqrrlvlivgt
kyageikksiftvmnylmpkrg

SCOPe Domain Coordinates for d2pc9b2:

Click to download the PDB-style file with coordinates for d2pc9b2.
(The format of our PDB-style files is described here.)

Timeline for d2pc9b2: