Lineage for d2pc9a2 (2pc9 A:2-211)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011363Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1011364Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 1011365Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 1011376Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 1011388Species Thermus thermophilus [TaxId:274] [82555] (3 PDB entries)
    Uniprot Q7SIC6
  8. 1011393Domain d2pc9a2: 2pc9 A:2-211 [149379]
    Other proteins in same PDB: d2pc9a1, d2pc9b1, d2pc9c1, d2pc9d1
    automatically matched to d1j3ba2
    complexed with atp, ca, po4

Details for d2pc9a2

PDB Entry: 2pc9 (more details), 2.4 Å

PDB Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d2pc9a2:

Sequence, based on SEQRES records: (download)

>d2pc9a2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
rlvlivgtkyageikksiftvmnylmpkrg

Sequence, based on observed residues (ATOM records): (download)

>d2pc9a2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvli
vgtkyageikksiftvmnylmpkrg

SCOPe Domain Coordinates for d2pc9a2:

Click to download the PDB-style file with coordinates for d2pc9a2.
(The format of our PDB-style files is described here.)

Timeline for d2pc9a2: