Lineage for d2pbzc2 (2pbz C:100-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217595Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 2217596Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 2217615Species Thermococcus kodakaraensis [TaxId:311400] [160806] (1 PDB entry)
    Uniprot Q5JD28 98-310
  8. 2217618Domain d2pbzc2: 2pbz C:100-312 [149376]
    Other proteins in same PDB: d2pbza1, d2pbzb1, d2pbzc1
    automated match to d2pbza2
    complexed with atp

Details for d2pbzc2

PDB Entry: 2pbz (more details), 2.5 Å

PDB Description: crystal structure of an imp biosynthesis protein purp from thermococcus kodakaraensis
PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2pbzc2:

Sequence, based on SEQRES records: (download)

>d2pbzc2 d.142.1.9 (C:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegprggsghfivegseleerlstleep
yrverfipgvylyvhffyspilerlellgvdervliadgnarwpvkplpytivgnraial
resllpqlydyglafvrtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwy
selywgerlsmgrriarelrlaeeedrleevvt

Sequence, based on observed residues (ATOM records): (download)

>d2pbzc2 d.142.1.9 (C:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegseleerlspyrverfipgvylyvhf
fyspilerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafv
rtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrria
relrlaeeedrleevvt

SCOPe Domain Coordinates for d2pbzc2:

Click to download the PDB-style file with coordinates for d2pbzc2.
(The format of our PDB-style files is described here.)

Timeline for d2pbzc2: