SCOP 1.75: Domain d2pbzc1: 2pbz C:4-99

Lineage for d2pbzc1 (2pbz C:4-99)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (8 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
   Pfam PF06849; DUF1246

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [159529] (1 PDB entry)
   Uniprot Q5JD28 2-97

8. Domain d2pbzc1: 2pbz C:4-99 [149375]
   Other proteins in same PDB: d2pbza2, d2pbzb2, d2pbzc2
   automatically matched to 2PBZ A:4-99
   complexed with atp

Details for d2pbzc1

PDB Entry: 2pbz, 2.5 Å

PDB Description: crystal structure of an imp biosynthesis protein purp from thermococcus kodakaraensis

PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d2pbzc1:

Sequence; same for both SEQRES and ATOM records:

>d2pbzc1 c.30.1.8 (C:4-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi
vvphgsfvaylgieaiekakarffgnrrflkwettf

Timeline for d2pbzc1:

• d2pbzc1 is new in SCOP 1.75
  
• d2pbzc1 appears in SCOPe 2.01
  
• d2pbzc1 appears in the current release, SCOPe 2.08