![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) ![]() |
![]() | Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein) Pfam PF06973; DUF1297 |
![]() | Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species) |
![]() | Species Thermococcus kodakaraensis [TaxId:311400] [160806] (1 PDB entry) Uniprot Q5JD28 98-310 |
![]() | Domain d2pbzb2: 2pbz B:100-312 [149374] Other proteins in same PDB: d2pbza1, d2pbzb1, d2pbzc1 automatically matched to 2PBZ A:100-312 complexed with atp |
PDB Entry: 2pbz (more details), 2.5 Å
SCOP Domain Sequences for d2pbzb2:
Sequence, based on SEQRES records: (download)
>d2pbzb2 d.142.1.9 (B:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} elqdkalegagiprvevvepedakpdelyfvriegprggsghfivegseleerlstleep yrverfipgvylyvhffyspilerlellgvdervliadgnarwpvkplpytivgnraial resllpqlydyglafvrtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwy selywgerlsmgrriarelrlaeeedrleevvt
>d2pbzb2 d.142.1.9 (B:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} elqdkalegagiprvevvepedakpdelyfvriegseleerlspyrverfipgvylyvhf fyspilerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafv rtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrria relrlaeeedrleevvt
Timeline for d2pbzb2:
![]() Domains from other chains: (mouse over for more information) d2pbza1, d2pbza2, d2pbzc1, d2pbzc2 |