SCOP 1.75: Domain d2pbzb2: 2pbz B:100-312

Lineage for d2pbzb2 (2pbz B:100-312)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
   Pfam PF06973; DUF1297

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [160806] (1 PDB entry)
   Uniprot Q5JD28 98-310

8. Domain d2pbzb2: 2pbz B:100-312 [149374]
   Other proteins in same PDB: d2pbza1, d2pbzb1, d2pbzc1
   automatically matched to 2PBZ A:100-312
   complexed with atp

Details for d2pbzb2

PDB Entry: 2pbz, 2.5 Å

PDB Description: crystal structure of an imp biosynthesis protein purp from thermococcus kodakaraensis

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2pbzb2:

Sequence, based on SEQRES records:

>d2pbzb2 d.142.1.9 (B:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegprggsghfivegseleerlstleep
yrverfipgvylyvhffyspilerlellgvdervliadgnarwpvkplpytivgnraial
resllpqlydyglafvrtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwy
selywgerlsmgrriarelrlaeeedrleevvt

Sequence, based on observed residues (ATOM records):

>d2pbzb2 d.142.1.9 (B:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegseleerlspyrverfipgvylyvhf
fyspilerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafv
rtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrria
relrlaeeedrleevvt

Timeline for d2pbzb2:

• d2pbzb2 is new in SCOP 1.75
  
• d2pbzb2 appears in SCOPe 2.01
  
• d2pbzb2 appears in the current release, SCOPe 2.08