Lineage for d2pbza2 (2pbz A:100-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928753Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 1928754Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 1928773Species Thermococcus kodakaraensis [TaxId:311400] [160806] (1 PDB entry)
    Uniprot Q5JD28 98-310
  8. 1928774Domain d2pbza2: 2pbz A:100-312 [149372]
    Other proteins in same PDB: d2pbza1, d2pbzb1, d2pbzc1
    complexed with atp

Details for d2pbza2

PDB Entry: 2pbz (more details), 2.5 Å

PDB Description: crystal structure of an imp biosynthesis protein purp from thermococcus kodakaraensis
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2pbza2:

Sequence, based on SEQRES records: (download)

>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegprggsghfivegseleerlstleep
yrverfipgvylyvhffyspilerlellgvdervliadgnarwpvkplpytivgnraial
resllpqlydyglafvrtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwy
selywgerlsmgrriarelrlaeeedrleevvt

Sequence, based on observed residues (ATOM records): (download)

>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
elqdkalegagiprvevvepedakpdelyfvriegseleerlspyrverfipgvylyvhf
fyspilerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafv
rtmreleppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrria
relrlaeeedrleevvt

SCOPe Domain Coordinates for d2pbza2:

Click to download the PDB-style file with coordinates for d2pbza2.
(The format of our PDB-style files is described here.)

Timeline for d2pbza2: