Lineage for d2pbza1 (2pbz A:4-99)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591644Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
    Pfam PF06849; DUF1246
  6. 1591645Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)
  7. 1591664Species Thermococcus kodakaraensis [TaxId:311400] [159529] (1 PDB entry)
    Uniprot Q5JD28 2-97
  8. 1591665Domain d2pbza1: 2pbz A:4-99 [149371]
    Other proteins in same PDB: d2pbza2, d2pbzb2, d2pbzc2
    complexed with atp

Details for d2pbza1

PDB Entry: 2pbz (more details), 2.5 Å

PDB Description: crystal structure of an imp biosynthesis protein purp from thermococcus kodakaraensis
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2pbza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbza1 c.30.1.8 (A:4-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]}
ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi
vvphgsfvaylgieaiekakarffgnrrflkwettf

SCOPe Domain Coordinates for d2pbza1:

Click to download the PDB-style file with coordinates for d2pbza1.
(The format of our PDB-style files is described here.)

Timeline for d2pbza1: