SCOP 1.75: Domain d2pbld1: 2pbl D:1-261

Lineage for d2pbld1 (2pbl D:1-261)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (6 proteins)

6. Protein Uncharacterized protein TM1040_2492 [159734] (1 species)

7. Species Silicibacter sp. tm1040 [TaxId:292414] [159735] (1 PDB entry)
   Uniprot Q1GDP2 1-261

8. Domain d2pbld1: 2pbl D:1-261 [149370]
   automatically matched to 2PBL A:1-261
   complexed with cl, mg, po4, unl

Details for d2pbld1

PDB Entry: 2pbl, 1.79 Å

PDB Description: crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution

PDB Compounds: (D:) Putative esterase/lipase/thioesterase

SCOP Domain Sequences for d2pbld1:

Sequence; same for both SEQRES and ATOM records:

>d2pbld1 c.69.1.2 (D:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}
melddayangayiegaadypprwaasaedfrnslqdrarlnlsygegdrhkfdlflpegt
pvglfvfvhggywmafdksswshlavgalskgwavampsyelcpevriseitqqisqavt
aaakeidgpivlaghsagghlvarmldpevlpeavgarirnvvpisplsdlrpllrtsmn
ekfkmdadaaiaespvemqnrydakvtvwvggaerpafldqaiwlveawdadhviafekh
hfnviepladpesdlvavita

Timeline for d2pbld1:

• d2pbld1 is new in SCOP 1.75
  
• d2pbld1 is called d2pbld_ in SCOPe 2.01
  
• d2pbld1 appears in the current release, SCOPe 2.08, called d2pbld2