Lineage for d2pbkb_ (2pbk B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062283Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2062284Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2062285Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 protein domains)
  6. 2062332Protein KSHV protease [50795] (1 species)
  7. 2062333Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [50796] (2 PDB entries)
  8. 2062335Domain d2pbkb_: 2pbk B: [149366]
    automated match to d1fl1a_
    complexed with act

Details for d2pbkb_

PDB Entry: 2pbk (more details), 1.73 Å

PDB Description: Crystal structure of KSHV protease in complex with hexapeptide phosphonate inhibitor
PDB Compounds: (B:) KSHV protease

SCOPe Domain Sequences for d2pbkb_:

Sequence, based on SEQRES records: (download)

>d2pbkb_ b.57.1.1 (B:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
qglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvs
hgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpre
lsqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrle
dlstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka

Sequence, based on observed residues (ATOM records): (download)

>d2pbkb_ b.57.1.1 (B:) KSHV protease {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
qglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvs
hgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpre
lsqpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrled
lstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka

SCOPe Domain Coordinates for d2pbkb_:

Click to download the PDB-style file with coordinates for d2pbkb_.
(The format of our PDB-style files is described here.)

Timeline for d2pbkb_: