| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Microsomal prostaglandin E synthase-2 [142363] (1 species) |
| Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries) Uniprot Q9N0A4 100-212 |
| Domain d2pbjd2: 2pbj D:100-212 [149364] Other proteins in same PDB: d2pbja1, d2pbjb1, d2pbjc1, d2pbjd1 automated match to d1z9ha2 complexed with cl, gsh, hem |
PDB Entry: 2pbj (more details), 2.8 Å
SCOPe Domain Sequences for d2pbjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbjd2 c.47.1.5 (D:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess
qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm
Timeline for d2pbjd2: