SCOPe 2.07: Domain d2pbjd2: 2pbj D:100-212

Lineage for d2pbjd2 (2pbj D:100-212)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Microsomal prostaglandin E synthase-2 [142363] (1 species)

7. Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries)
   Uniprot Q9N0A4 100-212

8. Domain d2pbjd2: 2pbj D:100-212 [149364]
   Other proteins in same PDB: d2pbja1, d2pbjb1, d2pbjc1, d2pbjd1
   automated match to d1z9ha2
   complexed with cl, gsh, hem

Details for d2pbjd2

PDB Entry: 2pbj, 2.8 Å

PDB Description: GSH-heme bound microsomal prostaglandin E synthase

PDB Compounds: (D:) Prostaglandin E synthase 2

SCOPe Domain Sequences for d2pbjd2:

Sequence; same for both SEQRES and ATOM records:

>d2pbjd2 c.47.1.5 (D:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess
qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm

Timeline for d2pbjd2:

• d2pbjd2 first appeared in SCOP 1.75
  
• d2pbjd2 appears in SCOPe 2.06
  
• d2pbjd2 appears in the current release, SCOPe 2.08