Lineage for d2pbjd2 (2pbj D:100-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877243Protein Microsomal prostaglandin E synthase-2 [142363] (1 species)
  7. 2877244Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries)
    Uniprot Q9N0A4 100-212
  8. 2877248Domain d2pbjd2: 2pbj D:100-212 [149364]
    Other proteins in same PDB: d2pbja1, d2pbjb1, d2pbjc1, d2pbjd1
    automated match to d1z9ha2
    complexed with cl, gsh, hem

    has additional insertions and/or extensions that are not grouped together

Details for d2pbjd2

PDB Entry: 2pbj (more details), 2.8 Å

PDB Description: GSH-heme bound microsomal prostaglandin E synthase
PDB Compounds: (D:) Prostaglandin E synthase 2

SCOPe Domain Sequences for d2pbjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbjd2 c.47.1.5 (D:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess
qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm

SCOPe Domain Coordinates for d2pbjd2:

Click to download the PDB-style file with coordinates for d2pbjd2.
(The format of our PDB-style files is described here.)

Timeline for d2pbjd2: