Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Microsomal prostaglandin E synthase-2 [140556] (1 species) |
Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries) Uniprot Q9N0A4 213-373 |
Domain d2pbjd1: 2pbj D:213-373 [149363] Other proteins in same PDB: d2pbja2, d2pbjb2, d2pbjc2, d2pbjd2 automated match to d1z9ha1 complexed with cl, gsh, hem |
PDB Entry: 2pbj (more details), 2.8 Å
SCOPe Domain Sequences for d2pbjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbjd1 a.45.1.1 (D:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl adlavygvlrvmegldafddlmqhthiqpwylrveraitea
Timeline for d2pbjd1: