SCOPe 2.06: Domain d2pbjd1: 2pbj D:213-373

Lineage for d2pbjd1 (2pbj D:213-373)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Microsomal prostaglandin E synthase-2 [140556] (1 species)

7. Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries)
   Uniprot Q9N0A4 213-373

8. Domain d2pbjd1: 2pbj D:213-373 [149363]
   Other proteins in same PDB: d2pbja2, d2pbjb2, d2pbjc2, d2pbjd2
   automated match to d1z9ha1
   complexed with cl, gsh, hem

Details for d2pbjd1

PDB Entry: 2pbj, 2.8 Å

PDB Description: GSH-heme bound microsomal prostaglandin E synthase

PDB Compounds: (D:) Prostaglandin E synthase 2

SCOPe Domain Sequences for d2pbjd1:

Sequence; same for both SEQRES and ATOM records:

>d2pbjd1 a.45.1.1 (D:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga
vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl
adlavygvlrvmegldafddlmqhthiqpwylrveraitea

Timeline for d2pbjd1:

• d2pbjd1 first appeared in SCOP 1.75
  
• d2pbjd1 appears in SCOPe 2.05
  
• d2pbjd1 appears in SCOPe 2.07
  
• d2pbjd1 appears in the current release, SCOPe 2.08