![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
![]() | Protein Microsomal prostaglandin E synthase-2 [140556] (1 species) |
![]() | Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries) Uniprot Q9N0A4 213-373 |
![]() | Domain d2pbjb1: 2pbj B:213-373 [149359] Other proteins in same PDB: d2pbja2, d2pbjb2, d2pbjc2, d2pbjd2 automatically matched to d1z9ha1 complexed with cl, gsh, hem |
PDB Entry: 2pbj (more details), 2.8 Å
SCOPe Domain Sequences for d2pbjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbjb1 a.45.1.1 (B:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl adlavygvlrvmegldafddlmqhthiqpwylrveraitea
Timeline for d2pbjb1: