Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Microsomal prostaglandin E synthase-2 [142363] (1 species) |
Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries) Uniprot Q9N0A4 100-212 |
Domain d2pbja2: 2pbj A:100-212 [149358] Other proteins in same PDB: d2pbja1, d2pbjb1, d2pbjc1, d2pbjd1 automatically matched to d1z9ha2 complexed with cl, gsh, hem |
PDB Entry: 2pbj (more details), 2.8 Å
SCOP Domain Sequences for d2pbja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbja2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm
Timeline for d2pbja2: