Lineage for d2pbja1 (2pbj A:213-373)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 916112Protein Microsomal prostaglandin E synthase-2 [140556] (1 species)
  7. 916113Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries)
    Uniprot Q9N0A4 213-373
  8. 916118Domain d2pbja1: 2pbj A:213-373 [149357]
    Other proteins in same PDB: d2pbja2, d2pbjb2, d2pbjc2, d2pbjd2
    automatically matched to d1z9ha1
    complexed with cl, gsh, hem

Details for d2pbja1

PDB Entry: 2pbj (more details), 2.8 Å

PDB Description: GSH-heme bound microsomal prostaglandin E synthase
PDB Compounds: (A:) Prostaglandin E synthase 2

SCOPe Domain Sequences for d2pbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbja1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga
vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl
adlavygvlrvmegldafddlmqhthiqpwylrveraitea

SCOPe Domain Coordinates for d2pbja1:

Click to download the PDB-style file with coordinates for d2pbja1.
(The format of our PDB-style files is described here.)

Timeline for d2pbja1: