SCOPe 2.05: Domain d2pbea1: 2pbe A:138-282

Lineage for d2pbea1 (2pbe A:138-282)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.5: AadK C-terminal domain-like [158607] (1 protein)
   C-terminal part of Pfam PF04439; Streptomycin adenylyltransferase; contains extra C-terminal helix

6. Protein Aminoglycoside 6-adenylyltransferase AadK [158608] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158609] (1 PDB entry)
   Uniprot P17585 138-282

8. Domain d2pbea1: 2pbe A:138-282 [149355]
   Other proteins in same PDB: d2pbea2

Details for d2pbea1

PDB Entry: 2pbe, 2.65 Å

PDB Description: crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis

PDB Compounds: (A:) Aminoglycoside 6-adenylyltransferase

SCOPe Domain Sequences for d2pbea1:

Sequence; same for both SEQRES and ATOM records:

>d2pbea1 a.160.1.5 (A:138-282) Aminoglycoside 6-adenylyltransferase AadK {Bacillus subtilis [TaxId: 1423]}
ndrqywikrptarefddccnefwmvstyvvkglarneilfaidhlneivrpnllrmmawh
iasqkgysfsmgknykfmkrylsnkeweelmstysvngyqemwkslftcyalfrkyskav
seglaykypdydegitkytegiycs

Timeline for d2pbea1:

• d2pbea1 first appeared in SCOP 1.75
  
• d2pbea1 appears in SCOPe 2.04
  
• d2pbea1 appears in SCOPe 2.06
  
• d2pbea1 appears in the current release, SCOPe 2.08