![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.5: AadK C-terminal domain-like [158607] (1 protein) C-terminal part of Pfam PF04439; Streptomycin adenylyltransferase; contains extra C-terminal helix |
![]() | Protein Aminoglycoside 6-adenylyltransferase AadK [158608] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [158609] (1 PDB entry) Uniprot P17585 138-282 |
![]() | Domain d2pbea1: 2pbe A:138-282 [149355] Other proteins in same PDB: d2pbea2, d2pbea3 |
PDB Entry: 2pbe (more details), 2.65 Å
SCOPe Domain Sequences for d2pbea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbea1 a.160.1.5 (A:138-282) Aminoglycoside 6-adenylyltransferase AadK {Bacillus subtilis [TaxId: 1423]} ndrqywikrptarefddccnefwmvstyvvkglarneilfaidhlneivrpnllrmmawh iasqkgysfsmgknykfmkrylsnkeweelmstysvngyqemwkslftcyalfrkyskav seglaykypdydegitkytegiycs
Timeline for d2pbea1: