Lineage for d2pbea1 (2pbe A:138-282)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735618Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2735619Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2735686Family a.160.1.5: AadK C-terminal domain-like [158607] (1 protein)
    C-terminal part of Pfam PF04439; Streptomycin adenylyltransferase; contains extra C-terminal helix
  6. 2735687Protein Aminoglycoside 6-adenylyltransferase AadK [158608] (1 species)
  7. 2735688Species Bacillus subtilis [TaxId:1423] [158609] (1 PDB entry)
    Uniprot P17585 138-282
  8. 2735689Domain d2pbea1: 2pbe A:138-282 [149355]
    Other proteins in same PDB: d2pbea2, d2pbea3

Details for d2pbea1

PDB Entry: 2pbe (more details), 2.65 Å

PDB Description: crystal structure of an aminoglycoside 6-adenyltransferase from bacillus subtilis
PDB Compounds: (A:) Aminoglycoside 6-adenylyltransferase

SCOPe Domain Sequences for d2pbea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbea1 a.160.1.5 (A:138-282) Aminoglycoside 6-adenylyltransferase AadK {Bacillus subtilis [TaxId: 1423]}
ndrqywikrptarefddccnefwmvstyvvkglarneilfaidhlneivrpnllrmmawh
iasqkgysfsmgknykfmkrylsnkeweelmstysvngyqemwkslftcyalfrkyskav
seglaykypdydegitkytegiycs

SCOPe Domain Coordinates for d2pbea1:

Click to download the PDB-style file with coordinates for d2pbea1.
(The format of our PDB-style files is described here.)

Timeline for d2pbea1: