| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily) 3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5 |
Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) ![]() |
| Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins) automatically mapped to Pfam PF10120 |
| Protein Phosphomethylpyrimidine kinase [159769] (1 species) |
| Species Pyrococcus furiosus [TaxId:2261] [159770] (1 PDB entry) Uniprot Q8U193 268-451 |
| Domain d2pb9b_: 2pb9 B: [149353] automated match to d2pb9a1 complexed with po4 |
PDB Entry: 2pb9 (more details), 2.7 Å
SCOPe Domain Sequences for d2pb9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pb9b_ c.74.1.2 (B:) Phosphomethylpyrimidine kinase {Pyrococcus furiosus [TaxId: 2261]}
ekwriyeeltnavrefesinpvrlipevgtnfvyslplpyarstkdvagvkgrivkygns
vkavgpvefgasdhlaravltymrfypeyrsainirysreiieeiieiaqergfkvsfyd
rreepeeikakegatipwgietaikrikerpdiiyhlgdvgkepmilvfgrnprevleki
kmli
Timeline for d2pb9b_: